DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc42 and rhoh

DIOPT Version :9

Sequence 1:NP_001245762.1 Gene:Cdc42 / 32981 FlyBaseID:FBgn0010341 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001314902.1 Gene:rhoh / 553413 ZFINID:ZDB-GENE-060228-7 Length:195 Species:Danio rerio


Alignment Length:193 Identity:76/193 - (39%)
Similarity:121/193 - (62%) Gaps:13/193 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRL 67
            ::|||:|||.|||||.||:.:|:..||..|.|||::|..|.|.:.|...:|||:||||.:.:.::
Zfish     8 SVKCVLVGDCAVGKTALLVRFTSETFPDSYRPTVYENTGVDVFMDGIQISLGLWDTAGHDTFRQI 72

  Fly    68 RPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLRDENSTLEKLAKN 132
            ||:||..|||.|:|:||.:|||..|::.||:.|:..:..|.|.|:|.||.|.|:       :...
Zfish    73 RPMSYQDTDVVLLCYSVANPSSLNNLRHKWIAEVREYLPKVPVLVVATQTDHRE-------MGPY 130

  Fly   133 KQKPITMEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEPPEPTKKRK------CK 189
            :....|..:|:::|:|::|..|:|||||:.:|::.||:.|:..|:.......:|:      ||
Zfish   131 RANCTTSPEGKQVAQEIRAKGYLECSALSNRGVQQVFECAVRTAVNRARRQTRRRLLNLNPCK 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc42NP_001245762.1 Cdc42 3..177 CDD:206664 72/173 (42%)
RHO 6..179 CDD:197554 72/172 (42%)
rhohNP_001314902.1 Rho 9..173 CDD:206641 72/170 (42%)
RHO 11..176 CDD:197554 72/171 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.