DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc42 and rhoub

DIOPT Version :9

Sequence 1:NP_001245762.1 Gene:Cdc42 / 32981 FlyBaseID:FBgn0010341 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001017784.2 Gene:rhoub / 550481 ZFINID:ZDB-GENE-050417-308 Length:237 Species:Danio rerio


Alignment Length:186 Identity:97/186 - (52%)
Similarity:132/186 - (70%) Gaps:0/186 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLR 68
            :|||.:||||||||.|::|||||.:|::||||.||:::..|.:.|:|..|.|.|||||:::|:||
Zfish    29 LKCVFLGDGAVGKTSLIVSYTTNGYPTKYVPTAFDDFSAVVQVDGQPVRLQLCDTAGQDEFDKLR 93

  Fly    69 PLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLRDENSTLEKLAKNK 133
            ...|.:|||.|:|||||||:||:|:.|||||||...|..||.:|||||.|||.:...|..||:.:
Zfish    94 HFCYTRTDVLLLCFSVVSPASFQNIGEKWVPEIRRRCPLTPVILVGTQCDLRQDVKVLIDLARRR 158

  Fly   134 QKPITMEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEPPEPTKKRKCK 189
            ::|:..|....||.::.||.|:|||:||||.||.|||.||...|...:...:|:.|
Zfish   159 ERPVLEEDARALADKIGAVSYIECSSLTQKNLKEVFDAAISVGLRHSDRRARRERK 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc42NP_001245762.1 Cdc42 3..177 CDD:206664 94/172 (55%)
RHO 6..179 CDD:197554 94/172 (55%)
rhoubNP_001017784.2 Wrch_1 29..198 CDD:133330 92/168 (55%)
RHO 31..202 CDD:197554 93/170 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.