Sequence 1: | NP_001245762.1 | Gene: | Cdc42 / 32981 | FlyBaseID: | FBgn0010341 | Length: | 191 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001265288.1 | Gene: | RHOH / 399 | HGNCID: | 686 | Length: | 191 | Species: | Homo sapiens |
Alignment Length: | 195 | Identity: | 79/195 - (40%) |
---|---|---|---|
Similarity: | 122/195 - (62%) | Gaps: | 13/195 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYD 65
Fly 66 RLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLRDENSTLEKLA 130
Fly 131 KNKQKPITMEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEPPEPTKKRK------CK 189
Fly 190 189 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cdc42 | NP_001245762.1 | Cdc42 | 3..177 | CDD:206664 | 75/173 (43%) |
RHO | 6..179 | CDD:197554 | 74/172 (43%) | ||
RHOH | NP_001265288.1 | Rho | 5..169 | CDD:206641 | 75/170 (44%) |
Effector region. /evidence=ECO:0000250 | 33..41 | 4/7 (57%) | |||
Interaction with ZAP70. /evidence=ECO:0000250 | 73..86 | 7/12 (58%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0393 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1091615at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |