DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc42 and Rac2

DIOPT Version :9

Sequence 1:NP_001245762.1 Gene:Cdc42 / 32981 FlyBaseID:FBgn0010341 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001008385.1 Gene:Rac2 / 366957 RGDID:1307568 Length:192 Species:Rattus norvegicus


Alignment Length:193 Identity:133/193 - (68%)
Similarity:157/193 - (81%) Gaps:3/193 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYD 65
            ||.|||||||||||||||||||||||.||.||:|||||||:..||:..:|..|||:|||||||||
  Rat     1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYD 65

  Fly    66 RLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLRDENSTLEKLA 130
            ||||||||||||||:|||:|||:|:|||:.||.||:.|||..||.:||||::||||:..|:|||.
  Rat    66 RLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLK 130

  Fly   131 KNKQKPITMEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEPPEPTK--KRKCKFL 191
            :.|..|||..||..|||::.:|||:|||||||:|||.||||||.|.| .|:||:  ||.|..|
  Rat   131 EKKLAPITYPQGLALAKDIDSVKYLECSALTQRGLKTVFDEAIRAVL-CPQPTRQQKRPCSLL 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc42NP_001245762.1 Cdc42 3..177 CDD:206664 123/173 (71%)
RHO 6..179 CDD:197554 122/172 (71%)
Rac2NP_001008385.1 Rac1_like 3..176 CDD:206663 122/172 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X103
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.