DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc42 and RhoU

DIOPT Version :9

Sequence 1:NP_001245762.1 Gene:Cdc42 / 32981 FlyBaseID:FBgn0010341 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001036266.1 Gene:RhoU / 31945 FlyBaseID:FBgn0083940 Length:582 Species:Drosophila melanogaster


Alignment Length:189 Identity:87/189 - (46%)
Similarity:113/189 - (59%) Gaps:7/189 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRL 67
            :||||:|||||||||.|::||..|:|..|::||..|.|...|.:...|..|.:.|||||:..|.|
  Fly   392 SIKCVLVGDGAVGKTNLILSYLENRFNPEHIPTASDIYNADVNVNESPVHLTICDTAGQDTLDPL 456

  Fly    68 RPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLRDENSTLEKLAKN 132
            |.|.||.:||||:|||||.|.:|..:|.||.|:...  .|...:|||||.|||...:.|.||..|
  Fly   457 RELCYPDSDVFLLCFSVVKPETFRAIKTKWAPKFAK--TKAALILVGTQADLRTSPNVLNKLQTN 519

  Fly   133 KQKPITMEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALE----PPEPTKKRK 187
            .::.|:......||..:.| ||:|.|:.||..:|:|||.||...|.    ||.|:..||
  Fly   520 GEEAISYADAWDLATTIGA-KYIETSSATQDKVKDVFDTAIWEGLVPTTLPPTPSFWRK 577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc42NP_001245762.1 Cdc42 3..177 CDD:206664 81/173 (47%)
RHO 6..179 CDD:197554 80/176 (45%)
RhoUNP_001036266.1 Wrch_1 393..562 CDD:133330 81/171 (47%)
RHO 395..559 CDD:197554 77/166 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24072
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.