DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc42 and Rhoh

DIOPT Version :9

Sequence 1:NP_001245762.1 Gene:Cdc42 / 32981 FlyBaseID:FBgn0010341 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001013448.1 Gene:Rhoh / 305341 RGDID:1307623 Length:191 Species:Rattus norvegicus


Alignment Length:195 Identity:80/195 - (41%)
Similarity:122/195 - (62%) Gaps:13/195 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYD 65
            :.:||||:|||.|||||.||:.:|:..||..|.|||::|..|.|.:.|...:|||:||||.:.:.
  Rat     2 LSSIKCVLVGDSAVGKTSLLVRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTAGNDAFR 66

  Fly    66 RLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLRDENSTLEKLA 130
            .:|||||.|.||.|:|:||.:.|||.|:|.||:.|:..:...||.|:|.||.|.|:       :.
  Rat    67 SIRPLSYQQADVVLMCYSVANHSSFLNLKNKWISEVRSNLPCTPVLVVATQTDQRE-------MG 124

  Fly   131 KNKQKPITMEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEPPEPTKKRK------CK 189
            .::...|...:|::||::::|..|:|||||:.:|::.||:.|:..|:.......:||      ||
  Rat   125 PHRASCINAIEGKRLAQDVRAKGYLECSALSNRGVQQVFECAVRTAVNQARRRNRRKLFSINECK 189

  Fly   190  189
              Rat   190  189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc42NP_001245762.1 Cdc42 3..177 CDD:206664 75/173 (43%)
RHO 6..179 CDD:197554 74/172 (43%)
RhohNP_001013448.1 Rho 5..169 CDD:206641 75/170 (44%)
RHO 7..173 CDD:197554 74/172 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.