DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc42 and Rhod

DIOPT Version :9

Sequence 1:NP_001245762.1 Gene:Cdc42 / 32981 FlyBaseID:FBgn0010341 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001099793.1 Gene:Rhod / 293660 RGDID:1310985 Length:210 Species:Rattus norvegicus


Alignment Length:174 Identity:80/174 - (45%)
Similarity:114/174 - (65%) Gaps:0/174 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLR 68
            ||.|:||||..|||.|::.:....||..|.||||:.|..|:.:.|:|..|.::|||||:||||||
  Rat    18 IKVVLVGDGGCGKTSLMMVFANGAFPESYNPTVFERYNATLQMKGKPVRLQIWDTAGQDDYDRLR 82

  Fly    69 PLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLRDENSTLEKLAKNK 133
            ||.||..:|.|:||.|.:|:||:||..:|.||:||.|:..|.::||.:||||.:...:..|.|.:
  Rat    83 PLFYPDANVLLLCFDVTNPNSFDNVSNRWYPEVTHFCKGVPIIVVGCKIDLRKDKVLVNTLRKKR 147

  Fly   134 QKPITMEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAAL 177
            .:|:|..:|..:|:.:.||.|:||||.....::.||.||...||
  Rat   148 LEPVTYHRGHDMARSVGAVAYLECSARLHDNVEAVFQEAAEVAL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc42NP_001245762.1 Cdc42 3..177 CDD:206664 78/172 (45%)
RHO 6..179 CDD:197554 78/172 (45%)
RhodNP_001099793.1 Rho4_like 16..210 CDD:206704 80/174 (46%)
RHO 20..192 CDD:197554 78/172 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.