DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc42 and Rhof

DIOPT Version :9

Sequence 1:NP_001245762.1 Gene:Cdc42 / 32981 FlyBaseID:FBgn0010341 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_780301.1 Gene:Rhof / 23912 MGIID:1345629 Length:211 Species:Mus musculus


Alignment Length:192 Identity:86/192 - (44%)
Similarity:124/192 - (64%) Gaps:4/192 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLR 68
            :|.|:||||..|||.||:.|....||..|.|:||:.|..:|.:|.:..||.|:||||||||||||
Mouse    20 LKIVIVGDGGCGKTSLLMVYCQGSFPEHYAPSVFEKYTASVTVGNKEVTLNLYDTAGQEDYDRLR 84

  Fly    69 PLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLRDENSTLEKLAKNK 133
            ||||..|.:.|:|:.|::|:|::||..||.||:||.|:..|.:|:|.:.|||.:...|.||...:
Mouse    85 PLSYQNTHLVLICYDVMNPTSYDNVLIKWFPEVTHFCRGIPTVLIGCKTDLRKDKEQLRKLRAAQ 149

  Fly   134 QKPITMEQGEKLAKELKAVKYVECSALTQKGLKNVFDEA---ILAALEPPEPTKK-RKCKFL 191
            .:|||..||....::::...|:||||..::.:::||.||   .|:||:..:..|| |.|..|
Mouse   150 LEPITYTQGLNACEQMRGALYLECSAKFRENVEDVFREAAKVALSALKKAQRQKKHRICLLL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc42NP_001245762.1 Cdc42 3..177 CDD:206664 79/175 (45%)
RHO 6..179 CDD:197554 80/175 (46%)
RhofNP_780301.1 Rho4_like 17..211 CDD:206704 85/190 (45%)
Effector region. /evidence=ECO:0000255 48..56 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.