DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc42 and RHOBTB2

DIOPT Version :9

Sequence 1:NP_001245762.1 Gene:Cdc42 / 32981 FlyBaseID:FBgn0010341 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001153508.1 Gene:RHOBTB2 / 23221 HGNCID:18756 Length:749 Species:Homo sapiens


Alignment Length:202 Identity:79/202 - (39%)
Similarity:117/202 - (57%) Gaps:30/202 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEY------VPTVF--DNYAVTV--------MIGGE 49
            ::|||||||||.|||||.|:.:...|...::|      ||||:  |.|.|..        ::...
Human    34 VETIKCVVVGDNAVGKTRLICARACNATLTQYQLLATHVPTVWAIDQYRVCQEVLERSRDVVDDV 98

  Fly    50 PYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVG 114
            ..:|.|:||.|  |:.:.|..:|.::||.::|||:.:|:|..:||..|.|||.|.|.:.|.:|||
Human    99 SVSLRLWDTFG--DHHKDRRFAYGRSDVVVLCFSIANPNSLHHVKTMWYPEIKHFCPRAPVILVG 161

  Fly   115 TQIDLRDENSTLEKLAKNKQ------KP---ITMEQGEKLAKELKAVKYVECSALTQKGLKNVFD 170
            .|:|||  .:.||.:.:.::      ||   :..|:|.::|||| .:.|.|.|.:.|.|:|:|||
Human   162 CQLDLR--YADLEAVNRARRPLARPIKPNEILPPEKGREVAKEL-GIPYYETSVVAQFGIKDVFD 223

  Fly   171 EAILAAL 177
            .||.|||
Human   224 NAIRAAL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc42NP_001245762.1 Cdc42 3..177 CDD:206664 77/198 (39%)
RHO 6..179 CDD:197554 76/197 (39%)
RHOBTB2NP_001153508.1 RhoBTB 35..229 CDD:133275 76/198 (38%)
RHO 39..230 CDD:197554 74/195 (38%)
BTB 280..>327 CDD:295341
BTB <443..492 CDD:197585
BTB <443..490 CDD:295341
BTB 513..615 CDD:279045
BTB 523..615 CDD:197585
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.