DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc42 and chw-1

DIOPT Version :9

Sequence 1:NP_001245762.1 Gene:Cdc42 / 32981 FlyBaseID:FBgn0010341 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_505686.1 Gene:chw-1 / 184848 WormBaseID:WBGene00009059 Length:207 Species:Caenorhabditis elegans


Alignment Length:183 Identity:85/183 - (46%)
Similarity:114/183 - (62%) Gaps:10/183 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLR 68
            :||:.||:.|||||.:::|||||.:|..||||.|||::|.|::..:|..|.|.|||||..:|.||
 Worm    10 LKCIFVGNAAVGKTSMIVSYTTNVYPHNYVPTAFDNFSVVVLVDKKPIRLQLHDTAGQSSFDTLR 74

  Fly    69 PLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLRDENSTLEKLAKNK 133
            ||.|...|||::.:|||...|||:|...|.||:|.....|..:|||||.|.|         .:.:
 Worm    75 PLCYTDADVFVIVYSVVDLQSFEDVSHHWYPEVTKRNPGTKLILVGTQADQR---------WQVR 130

  Fly   134 QKPITMEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEPPEPTKKR 186
            ...:|..:|:.||..|.| ::.|||||||..||.:||.||||.||..:..:||
 Worm   131 GNTVTQLRGKALADRLGA-EFFECSALTQHNLKQMFDAAILAGLEGKKNREKR 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc42NP_001245762.1 Cdc42 3..177 CDD:206664 81/172 (47%)
RHO 6..179 CDD:197554 81/172 (47%)
chw-1NP_505686.1 Wrch_1 10..172 CDD:133330 80/171 (47%)
RHO 12..174 CDD:197554 80/171 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.