DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc42 and crp-1

DIOPT Version :9

Sequence 1:NP_001245762.1 Gene:Cdc42 / 32981 FlyBaseID:FBgn0010341 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_505688.1 Gene:crp-1 / 179462 WormBaseID:WBGene00012532 Length:187 Species:Caenorhabditis elegans


Alignment Length:186 Identity:81/186 - (43%)
Similarity:115/186 - (61%) Gaps:15/186 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLR 68
            :|.|||||...|||.||::||..:|...|..|||||:||:|.|..:.|.:.|||||||.:|:::|
 Worm     5 LKLVVVGDTYTGKTSLLVAYTKKQFLDNYTTTVFDNWAVSVHIDNKNYAVNLFDTAGQGNYEQIR 69

  Fly    69 PLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHC-QKTPFLLVGTQIDLRDENSTLEKLAKN 132
            .||||..:|||||||::...:.|:.:..|:|||..:. ...|.:||||:.||.|:        .:
 Worm    70 CLSYPHANVFLVCFSMIDRKTLESCRSTWIPEIRKYAGDNVPIMLVGTKNDLVDD--------AD 126

  Fly   133 KQKPITMEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAAL------EPPEP 182
            .:..:|.:..:::|.|:...|:..|||||.||||.||||:.|||:      |.|.|
 Worm   127 SRNTVTEDYAKRVAHEIGCHKFYSCSALTHKGLKRVFDESFLAAVGVKLEEETPNP 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc42NP_001245762.1 Cdc42 3..177 CDD:206664 77/173 (45%)
RHO 6..179 CDD:197554 77/179 (43%)
crp-1NP_505688.1 Rho 5..169 CDD:206641 75/171 (44%)
RHO 7..171 CDD:197554 76/171 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24072
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.