DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc42 and cdc-42

DIOPT Version :9

Sequence 1:NP_001245762.1 Gene:Cdc42 / 32981 FlyBaseID:FBgn0010341 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_495598.1 Gene:cdc-42 / 174233 WormBaseID:WBGene00000390 Length:191 Species:Caenorhabditis elegans


Alignment Length:191 Identity:169/191 - (88%)
Similarity:181/191 - (94%) Gaps:0/191 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYD 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
 Worm     1 MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYD 65

  Fly    66 RLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLRDENSTLEKLA 130
            ||||||||||||||||||||:|:|||||:|||||||:|||.||||||||||:||||:...|||||
 Worm    66 RLRPLSYPQTDVFLVCFSVVAPASFENVREKWVPEISHHCSKTPFLLVGTQVDLRDDPGMLEKLA 130

  Fly   131 KNKQKPITMEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEPPEPTKKRKCKFL 191
            ||||||::.:.||||||||||||||||||||||||||||||||||||:||:..||:||..|
 Worm   131 KNKQKPVSTDVGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALDPPQQEKKKKCNIL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc42NP_001245762.1 Cdc42 3..177 CDD:206664 158/173 (91%)
RHO 6..179 CDD:197554 157/172 (91%)
cdc-42NP_495598.1 Cdc42 3..177 CDD:206664 158/173 (91%)
RHO 6..179 CDD:197554 157/172 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157376
Domainoid 1 1.000 323 1.000 Domainoid score I650
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H123986
Inparanoid 1 1.050 352 1.000 Inparanoid score I1326
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 1 1.000 - - oto18061
orthoMCL 1 0.900 - - OOG6_104797
Panther 1 1.100 - - LDO PTHR24072
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R181
SonicParanoid 1 1.000 - - X103
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.830

Return to query results.
Submit another query.