DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc42 and Rnd2

DIOPT Version :9

Sequence 1:NP_001245762.1 Gene:Cdc42 / 32981 FlyBaseID:FBgn0010341 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_033838.1 Gene:Rnd2 / 11858 MGIID:1338755 Length:227 Species:Mus musculus


Alignment Length:174 Identity:71/174 - (40%)
Similarity:109/174 - (62%) Gaps:1/174 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRP 69
            |.|||||...|||.||..:..:.:|..||||||:||..:..|......|.::||:|...||.:||
Mouse     9 KIVVVGDAECGKTALLQVFAKDAYPGSYVPTVFENYTASFEIDKRRIELNMWDTSGSSYYDNVRP 73

  Fly    70 LSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLRDENSTLEKLAKNKQ 134
            |:||.:|..|:||.:..|.:.::|.:||..|....|.....:|||.::|:|.:.:||.:|:|.:.
Mouse    74 LAYPDSDAVLICFDISRPETLDSVLKKWQGETQEFCPNAKVVLVGCKLDMRTDLATLRELSKQRL 138

  Fly   135 KPITMEQGEKLAKELKAVKYVECSA-LTQKGLKNVFDEAILAAL 177
            .|:|.|||..|||::.||.|||||: .:::.:::||..|.:|:|
Mouse   139 IPVTHEQGTVLAKQVGAVSYVECSSRSSERSVRDVFHVATVASL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc42NP_001245762.1 Cdc42 3..177 CDD:206664 70/172 (41%)
RHO 6..179 CDD:197554 70/173 (40%)
Rnd2NP_033838.1 Rnd2_Rho7 7..227 CDD:206736 71/174 (41%)
Effector region. /evidence=ECO:0000255 36..44 6/7 (86%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..227
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.