Sequence 1: | NP_001245762.1 | Gene: | Cdc42 / 32981 | FlyBaseID: | FBgn0010341 | Length: | 191 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_003199615.1 | Gene: | rhobtb1 / 100537290 | ZFINID: | ZDB-GENE-130530-871 | Length: | 687 | Species: | Danio rerio |
Alignment Length: | 202 | Identity: | 78/202 - (38%) |
---|---|---|---|
Similarity: | 115/202 - (56%) | Gaps: | 30/202 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEY------VPTVF--DNYAVTV--------MIGGE 49
Fly 50 PYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVG 114
Fly 115 TQIDLRDENSTLEKLAKNKQ------KP---ITMEQGEKLAKELKAVKYVECSALTQKGLKNVFD 170
Fly 171 EAILAAL 177 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cdc42 | NP_001245762.1 | Cdc42 | 3..177 | CDD:206664 | 76/198 (38%) |
RHO | 6..179 | CDD:197554 | 75/197 (38%) | ||
rhobtb1 | XP_003199615.1 | RhoBTB | 9..203 | CDD:133275 | 75/198 (38%) |
BTB | 355..446 | CDD:333434 | |||
BTB | 477..569 | CDD:197585 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0393 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |