Sequence 1: | NP_001245762.1 | Gene: | Cdc42 / 32981 | FlyBaseID: | FBgn0010341 | Length: | 191 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_004912583.1 | Gene: | rhobtb2 / 100144291 | XenbaseID: | XB-GENE-964295 | Length: | 718 | Species: | Xenopus tropicalis |
Alignment Length: | 200 | Identity: | 77/200 - (38%) |
---|---|---|---|
Similarity: | 114/200 - (56%) | Gaps: | 26/200 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEY------VPTVF--DNYAVTV--------MIGGE 49
Fly 50 PYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVG 114
Fly 115 TQIDLR-----DENSTLEKLAK--NKQKPITMEQGEKLAKELKAVKYVECSALTQKGLKNVFDEA 172
Fly 173 ILAAL 177 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cdc42 | NP_001245762.1 | Cdc42 | 3..177 | CDD:206664 | 75/196 (38%) |
RHO | 6..179 | CDD:197554 | 73/194 (38%) | ||
rhobtb2 | XP_004912583.1 | RhoBTB | 46..240 | CDD:133275 | 75/196 (38%) |
BTB_POZ | 283..470 | CDD:365784 | |||
BTB_POZ | 475..598 | CDD:365784 | |||
BACK | 603..699 | CDD:391941 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |