DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc42 and rhobtb2

DIOPT Version :9

Sequence 1:NP_001245762.1 Gene:Cdc42 / 32981 FlyBaseID:FBgn0010341 Length:191 Species:Drosophila melanogaster
Sequence 2:XP_004912583.1 Gene:rhobtb2 / 100144291 XenbaseID:XB-GENE-964295 Length:718 Species:Xenopus tropicalis


Alignment Length:200 Identity:77/200 - (38%)
Similarity:114/200 - (56%) Gaps:26/200 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEY------VPTVF--DNYAVTV--------MIGGE 49
            ::|||||||||.|||||.|:.:...|...::|      ||||:  |.|.|..        ::...
 Frog    45 VETIKCVVVGDNAVGKTRLICARACNATLTQYQLLATHVPTVWAIDQYRVCQEVLERSRDVVDDV 109

  Fly    50 PYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVG 114
            ..:|.|:||.|  |:.:.|..:|.::||.::|||:.:|:|.::|:..|.|||.|.|.:.|.:|||
 Frog   110 SVSLRLWDTFG--DHHKDRRFAYGRSDVVVLCFSIANPNSLQHVQTMWYPEIKHFCPRAPVILVG 172

  Fly   115 TQIDLR-----DENSTLEKLAK--NKQKPITMEQGEKLAKELKAVKYVECSALTQKGLKNVFDEA 172
            .|:|||     ..|.....||:  ..|:.:..|:|.::|||| .:.|.|.|.:.|.|:|.|||.|
 Frog   173 CQLDLRYADLEAVNRARRPLARPIRPQEILPPEKGREVAKEL-GIPYYETSVVAQCGIKEVFDNA 236

  Fly   173 ILAAL 177
            |.:||
 Frog   237 IRSAL 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc42NP_001245762.1 Cdc42 3..177 CDD:206664 75/196 (38%)
RHO 6..179 CDD:197554 73/194 (38%)
rhobtb2XP_004912583.1 RhoBTB 46..240 CDD:133275 75/196 (38%)
BTB_POZ 283..470 CDD:365784
BTB_POZ 475..598 CDD:365784
BACK 603..699 CDD:391941
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.