DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc42 and rhov

DIOPT Version :9

Sequence 1:NP_001245762.1 Gene:Cdc42 / 32981 FlyBaseID:FBgn0010341 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001012250.1 Gene:rhov / 100005849 ZFINID:ZDB-GENE-031002-10 Length:235 Species:Danio rerio


Alignment Length:186 Identity:92/186 - (49%)
Similarity:128/186 - (68%) Gaps:4/186 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLR 68
            |.|::|||||||||.:::|||||.:|::|..|.||.::..|.:.|.|..:.|.||||||::|..|
Zfish    30 ISCMLVGDGAVGKTSMIVSYTTNGYPTDYKQTAFDVFSGQVQVDGTPVRIQLMDTAGQEEFDEFR 94

  Fly    69 PLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLRDENSTLEKLAKNK 133
            .|||..|||||:|||||:|:||:|:.:||:|||......:|.:|||||.||..:.:.|..|.:.|
Zfish    95 SLSYAHTDVFLLCFSVVNPTSFQNITKKWIPEIRECNPSSPIILVGTQSDLVLDVNVLIDLDRYK 159

  Fly   134 QKPITMEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEPPEPTKKRKCK 189
            .||:...:...|:::::|.:||||||||||.||..||.||.||::    .|.||.|
Zfish   160 VKPVCSSRARSLSEKIRAAEYVECSALTQKNLKEAFDAAIFAAIK----HKARKAK 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc42NP_001245762.1 Cdc42 3..177 CDD:206664 87/172 (51%)
RHO 6..179 CDD:197554 87/172 (51%)
rhovNP_001012250.1 Wrch_1 30..193 CDD:133330 81/162 (50%)
RHO 32..193 CDD:197554 80/160 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.