DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mer and CCDC120

DIOPT Version :9

Sequence 1:NP_001285458.1 Gene:Mer / 32979 FlyBaseID:FBgn0086384 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_001156793.2 Gene:CCDC120 / 90060 HGNCID:28910 Length:696 Species:Homo sapiens


Alignment Length:319 Identity:62/319 - (19%)
Similarity:111/319 - (34%) Gaps:105/319 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 QAKEEKQRRQIERKKFIREK---KLRE-------KAE-------------HERYELEK-----SM 354
            |.|.|:.|..::|::.::|.   ||:|       :||             .||.:|.:     :.
Human    61 QVKSERLRGLLDRQRTLQEALSLKLQELRKVCLQEAELTGQLPPECPLEPGERPQLVRRRPPTAR 125

  Fly   355 EHLQNEMRMANDALRRSEETKELYFEKSRVNEEQMQLTECK---ANHFKTEMDRLRERQMKIE-- 414
            .:.......|:.:|..:||......|:....::|:.....:   |....|| .|.|.||::.:  
Human   126 AYPPPHPNQAHHSLCPAEELALEALEREVSVQQQIAAAARRLALAPDLSTE-QRRRRRQVQADAL 189

  Fly   415 REKHDLEKKIRDA------------------------------DFYVHQLTVENDKREAETEKLR 449
            |..|:||:::||.                              ...:.||:.|:....:|:..|.
Human   190 RRLHELEEQLRDVRARLGLPVLPLPQPLPLSTGSVITTQGVCLGMRLAQLSQEDVVLHSESSSLS 254

  Fly   450 KELI---------CAKMAEREATARLLEFLN--SG-------------------RKSSTDSLLTA 484
            :...         |..:|||.:..:..:.|.  ||                   .||..:|:.:.
Human   255 ESGASHDNEEPHGCFSLAERPSPPKAWDQLRAVSGGSPERRTPWKPPPSDLYGDLKSRRNSVASP 319

  Fly   485 SSVSHA-ANTASSMAAISTPSLITSSSTNDLETAGGAELT----THSSHYLVQGDNSSG 538
            :|.:.: ..:|||....|.|      :|..|....|.:|.    .||..:....|:..|
Human   320 TSPTRSLPRSASSFEGRSVP------ATPVLTRGAGPQLCKPEGLHSRQWSGSQDSQMG 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MerNP_001285458.1 B41 14..216 CDD:214604
FERM_C_ERM 210..306 CDD:270015
ERM 341..635 CDD:395622 54/293 (18%)
CCDC120NP_001156793.2 DUF3338 43..176 CDD:288652 21/114 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3529
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.