DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mer and ccdc120b

DIOPT Version :9

Sequence 1:NP_001285458.1 Gene:Mer / 32979 FlyBaseID:FBgn0086384 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_001070919.2 Gene:ccdc120b / 768286 ZFINID:ZDB-GENE-061027-93 Length:615 Species:Danio rerio


Alignment Length:284 Identity:59/284 - (20%)
Similarity:94/284 - (33%) Gaps:92/284 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 KGNHDLYMRRRKPDTMEIQQMKAQAKEEKQRRQIERKKFIREKKLREKAEHERYELEKSMEHLQN 359
            ||.....|....||....|..|.||         ||...::|:|             :|::.|.|
Zfish     4 KGRVITAMGLGSPDVQGCQDSKLQA---------ERVSELQERK-------------QSLQSLLN 46

  Fly   360 ----EMRMANDALRRSEETKELYFEKSRVNEEQMQLTECKANHF-------------KTEMDRLR 407
                |:|..  .|..:|.|.:|        .....|.|.:...|             |.:.|..:
Zfish    47 SRLGELRQV--CLLEAELTGKL--------PRDFPLEEGERPPFVQRRSGLPPYVTSKGDDDAGQ 101

  Fly   408 ERQMK----------IEREKHDLEKKIRDADFYVH-QLTV-------------ENDKREAETEKL 448
            .||||          |:.:|:.|..| |......| :.||             :|:.........
Zfish   102 RRQMKALFSGALRRSIDSDKNALHSK-RTVHRGCHTEETVKSESSSMSDSTSHDNEDSSPSVAPE 165

  Fly   449 RKELICAKMAEREATARLLEFLN---------SGRKSSTDSLLTASSVSHAANTASSMAAISTPS 504
            .:.|...::|.....:||...|:         :.|.|::.|:..:.|:..:|:.....:..:||.
Zfish   166 HRSLSHPRLAPSSPDSRLCRKLSPVEIYYEMRTRRNSASSSVSPSHSLPRSASNVEGRSVPATPL 230

  Fly   505 LITSSSTNDL------ETAGGAEL 522
            |   |.|..:      |.:||..|
Zfish   231 L---SRTAPISVHVRPEVSGGIAL 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MerNP_001285458.1 B41 14..216 CDD:214604
FERM_C_ERM 210..306 CDD:270015 3/10 (30%)
ERM 341..635 CDD:395622 46/238 (19%)
ccdc120bNP_001070919.2 DUF3338 12..>86 CDD:288652 22/105 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3529
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.