DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mer and sstn

DIOPT Version :9

Sequence 1:NP_001285458.1 Gene:Mer / 32979 FlyBaseID:FBgn0086384 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_648745.1 Gene:sstn / 39643 FlyBaseID:FBgn0036476 Length:635 Species:Drosophila melanogaster


Alignment Length:337 Identity:66/337 - (19%)
Similarity:129/337 - (38%) Gaps:72/337 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 KAQAKEEKQRRQIERKKFIREKKLREKAEHERYELEKSMEHLQNEMRMANDALRRSEETKELYFE 380
            |.:...:.::..:|.:|...|::|.||:            .|..:::....|:....      :|
  Fly    51 KIEDDPKVRKENLEARKQALEQRLSEKS------------WLLQQIQKQETAIINGN------YE 97

  Fly   381 KSRVNEEQMQLTECKANHFKTEMD---RLRERQMKIEREKHDLEKKIRDADFYVHQLTVENDKRE 442
            ...|||..:||    |..:|.|..   ..||....:.|::....::.||:     |:|:.|:.|:
  Fly    98 HMTVNEFFVQL----AQQYKHEQQLQALARENSSILRRKQSTTSRESRDS-----QMTINNNNRQ 153

  Fly   443 AETEKLRK---------------ELICAKMAEREATAR--LLEFLNSGRKSSTDSLLTASSVSH- 489
            :||...|.               :::...:|:::|..:  |::.....|.:.|.|.:......| 
  Fly   154 SETLSNRSSEYDNYQPSSSAGAGDMLVIGVAQQQAQQQPPLVKSALKKRPTPTPSQMQYMRQQHQ 218

  Fly   490 -AANTASSM-AAISTPSLITSSSTNDLETA---GGAELTTHSSHYLVQGDN--SSGISDDFEPKE 547
             .|:.|.:| ...|.|.:|:..|.|....|   ...::.......:||.|.  .|.....:....
  Fly   219 QQAHLAMNMNYQRSQPDVISMYSANSSNVATLRQPPQVAPQQQPIIVQCDKYYLSPTHQSYNEGG 283

  Fly   548 FILTDNEMEQITNEM-ERNHLDY----LRNSKQVQSQLQTLR---------SEIAPHKIE---EN 595
            ||.:...:::..:.| ..:::.|    .||....|.||..:.         .|.|.|:.:   .:
  Fly   284 FIKSSQNIKKYVSPMASPSNISYEQQQQRNPLHHQRQLDAISLAPSYVSVDMEAAQHQQQYRWRS 348

  Fly   596 QSNLDILSEAQI 607
            ||::..|:..|:
  Fly   349 QSHIAPLTPPQL 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MerNP_001285458.1 B41 14..216 CDD:214604
FERM_C_ERM 210..306 CDD:270015
ERM 341..635 CDD:395622 61/312 (20%)
sstnNP_648745.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3529
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.