DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mer and Inava

DIOPT Version :9

Sequence 1:NP_001285458.1 Gene:Mer / 32979 FlyBaseID:FBgn0086384 Length:635 Species:Drosophila melanogaster
Sequence 2:XP_006249982.1 Gene:Inava / 289399 RGDID:1311892 Length:678 Species:Rattus norvegicus


Alignment Length:343 Identity:73/343 - (21%)
Similarity:108/343 - (31%) Gaps:123/343 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 PDTMEIQQMKAQAKE-EKQRRQIE----------RKKFIREKKLR------------EKAEHER- 347
            ||: .:..||..... .||:|.:|          |:..:||.:|.            |||...| 
  Rat   120 PDS-PVSPMKELTNAVRKQQRALEARLEACLEELRRLCLREAELTGTLPAEYPLKPGEKAPKVRR 183

  Fly   348 -----YELEKSMEHLQNEMRMANDALRRSEETKELYFEKSRVNEEQMQLTE-----CKANHFKTE 402
                 |:|::...|.:       |.|...|....|          |:|:||     |...:...:
  Rat   184 RIGAAYKLDEWALHRE-------DPLSSLERQLAL----------QLQITEAARRLCAEENLSRQ 231

  Fly   403 MDRLRERQMKIEREKHDLEKKIRDADFYVHQLTVENDKREAE-----TEKLRKELICAKMAEREA 462
            ..|.|:.....|      |||:||.     |..:.:.:|.:|     ...|.:||..        
  Rat   232 ARRQRKHAALQE------EKKLRDL-----QRCLGDRRRNSEPPPSTVPSLGRELSA-------- 277

  Fly   463 TARLLEFLNSGRKSSTDSLLTASSVSHAAN-TASSMAAISTPSLITSSSTNDLETAGGAELTTHS 526
                     |...|.:|.||.....|.|.. ...|.|..|.|  :...|...|:..         
  Rat   278 ---------SDDSSLSDGLLLEEEDSQAPKPPPESPAPPSRP--LPPQSLEGLQPT--------- 322

  Fly   527 SHYLVQGDNSSGISDDFEPKEFILTDNEMEQITNE-MERNHLDYLRNSKQVQSQLQTLRSEIAPH 590
                  |..|.|:              |...|.|. .:...||:.....:..|:|.:..|  :|.
  Rat   323 ------GPESGGL--------------ERAPIQNSPWKETSLDHPYEKPRKSSELSSESS--SPA 365

  Fly   591 KIEENQ---SNLDILSEA 605
            ...::|   |||.:|..|
  Rat   366 TTPQDQPSPSNLWVLDAA 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MerNP_001285458.1 B41 14..216 CDD:214604
FERM_C_ERM 210..306 CDD:270015
ERM 341..635 CDD:395622 61/286 (21%)
InavaXP_006249982.1 DUF3338 108..231 CDD:288652 28/128 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3529
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.