powered by:
Protein Alignment CG14227 and slc17a7
DIOPT Version :9
Sequence 1: | NP_608345.2 |
Gene: | CG14227 / 32978 |
FlyBaseID: | FBgn0031058 |
Length: | 286 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001072608.1 |
Gene: | slc17a7 / 780064 |
XenbaseID: | XB-GENE-5742677 |
Length: | 576 |
Species: | Xenopus tropicalis |
Alignment Length: | 45 |
Identity: | 9/45 - (20%) |
Similarity: | 20/45 - (44%) |
Gaps: | 3/45 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 230 GDSGGPFSAKILYGGTYRTFQFGIIIFGLSSCAGLSVCTNVTFYM 274
|:|.|..:....:...:|.|...:.::.:... :.|.:.|||:
Frog 279 GESTGLMNPMAKFKAPWRKFFTSMPVYAIIVA---NFCRSWTFYL 320
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165162653 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.