DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and slc17a7

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001072608.1 Gene:slc17a7 / 780064 XenbaseID:XB-GENE-5742677 Length:576 Species:Xenopus tropicalis


Alignment Length:45 Identity:9/45 - (20%)
Similarity:20/45 - (44%) Gaps:3/45 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 GDSGGPFSAKILYGGTYRTFQFGIIIFGLSSCAGLSVCTNVTFYM 274
            |:|.|..:....:...:|.|...:.::.:...   :.|.:.|||:
 Frog   279 GESTGLMNPMAKFKAPWRKFFTSMPVYAIIVA---NFCRSWTFYL 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 9/45 (20%)
Tryp_SPc 57..277 CDD:238113 9/45 (20%)
slc17a7NP_001072608.1 2A0114euk 62..503 CDD:129972 9/45 (20%)
MFS 67..490 CDD:119392 9/45 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 517..547
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165162653
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.