DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and Prss8

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_579929.1 Gene:Prss8 / 76560 MGIID:1923810 Length:339 Species:Mus musculus


Alignment Length:303 Identity:83/303 - (27%)
Similarity:129/303 - (42%) Gaps:71/303 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLILFASLFLGSR-EGSAFLLDAECGRSLPT------NAKLTWWNYFDSSTDIQANPWIVSVIVN 65
            :|:|...|..|.| :|:    :|.||..:..      :||...|            ||.||:..:
Mouse    17 ILLLLGLLQSGIRADGT----EASCGAVIQPRITGGGSAKPGQW------------PWQVSITYD 65

  Fly    66 GKAKCSGSLINHRFVLTAAHCV----FREAMQVHLG--DFDAWNPGQNCSSGARLSNAYCVR-ID 123
            |...|.|||:::::|::||||.    .|||.:|.||  ..|::            ||...|. :.
Mouse    66 GNHVCGGSLVSNKWVVSAAHCFPREHSREAYEVKLGAHQLDSY------------SNDTVVHTVA 118

  Fly   124 KKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAID-----RFQLTVWGTTAE 183
            :.|.|:.: :.:..|.||.|:|:...|.:|.::|||||    |.|...     ...:|.||..|.
Mouse   119 QIITHSSY-REEGSQGDIALIRLSSPVTFSRYIRPICL----PAANASFPNGLHCTVTGWGHVAP 178

  Fly   184 DFR-SIPRVLKHSVGDRIDRELCTLKFQ--------QQVDESQICVH--TETSHACKGDSGGPFS 237
            ... ..||.|:......|.||.|:..:.        ..:.:..:|..  .....||:||||||.|
Mouse   179 SVSLQTPRPLQQLEVPLISRETCSCLYNINAVPEEPHTIQQDMLCAGYVKGGKDACQGDSGGPLS 243

  Fly   238 AKILYGGTYRTFQFGIIIFGLSSCAGLS---VCTNVTFYMDWI 277
            ..:  .|.:  :..||:.:| .:|...:   |.|..:.|..||
Mouse   244 CPM--EGIW--YLAGIVSWG-DACGAPNRPGVYTLTSTYASWI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 69/245 (28%)
Tryp_SPc 57..277 CDD:238113 69/245 (28%)
Prss8NP_579929.1 Tryp_SPc 45..284 CDD:238113 74/271 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.