DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and XB5723326

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001037931.1 Gene:XB5723326 / 733551 XenbaseID:XB-GENE-5723327 Length:349 Species:Xenopus tropicalis


Alignment Length:284 Identity:68/284 - (23%)
Similarity:118/284 - (41%) Gaps:59/284 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CG-RSLPTNAKLTWWNYFDSSTDIQAN----PWIVS----VIVNGKAKCSGSLINHRFVLTAAHC 86
            || |...|..|.::      ||::...    |||||    |.:..|..|:|:::|:.:::|||||
 Frog     3 CGNRPFYTEVKASY------STELNPVEGKWPWIVSIQKKVELGYKHICAGTILNNEWIITAAHC 61

  Fly    87 VFRE--------AMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIVHAGFGKIQAQQYDIGL 143
             |::        .::|.||.|.....|....|..         :.:.|.|..:..| .:..||.|
 Frog    62 -FKDWKEGDPTTPLRVLLGTFYLSEIGLRTQSRG---------VKQLIKHDQYDPI-TESNDIAL 115

  Fly   144 LRMQHAVQYSDFVRPICL---------LINEPVAAIDRFQLTVWGTTAEDFRSIPRVLKHSVGDR 199
            :::...|::||.::..|.         ||:..:|.        ||...:......:.|:.:..:|
 Frog   116 IQLDKQVEFSDHIQQACFPKESADLKDLIDCSIAG--------WGAQGKHLDEPSQFLQEAQVER 172

  Fly   200 IDRELCTLKFQQQVDESQICV-HTE-TSHACKGDSGGPFSAKILYGGTYRTFQFGIIIFGLSSCA 262
            ||.:.|...:|..:.|:.:|. |.: ....|.||.|.|...:......|..  .||:.:| |.|.
 Frog   173 IDTKHCNKWYQGILGENHLCAGHRKGPEKTCNGDRGSPLMCRTKKNNVYSV--IGILNWG-SGCG 234

  Fly   263 ---GLSVCTNVTFYMDWIWDALVN 283
               ...|.:.:..::.||.:.:.|
 Frog   235 QTRSPGVYSPIQSHIKWIVEKVKN 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 58/245 (24%)
Tryp_SPc 57..277 CDD:238113 58/245 (24%)
XB5723326NP_001037931.1 Tryp_SPc 25..252 CDD:214473 58/248 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.