DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and TMPRSS2

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001128571.1 Gene:TMPRSS2 / 7113 HGNCID:11876 Length:529 Species:Homo sapiens


Alignment Length:242 Identity:63/242 - (26%)
Similarity:103/242 - (42%) Gaps:44/242 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PWIVSVIVNGKAKCSGSLINHRFVLTAAHCVFREAMQVHLGDFDAWNPGQNCSSGARLSNAYC-- 119
            ||.||:.|.....|.||:|...:::||||||.:...          ||....:....|..::.  
Human   305 PWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLN----------NPWHWTAFAGILRQSFMFY 359

  Fly   120 ---VRIDKKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAIDRFQL---TVW 178
               .:::|.|.|..:.. :.:..||.|:::|..:.::|.|:|:||  ..|...:...||   :.|
Human   360 GAGYQVEKVISHPNYDS-KTKNNDIALMKLQKPLTFNDLVKPVCL--PNPGMMLQPEQLCWISGW 421

  Fly   179 GTTAEDFRSIPRVLKHSVGDRIDRELCTLK--FQQQVDESQICVHTETSH--ACKGDSGGPFSAK 239
            |.|.|..:: ..||..:....|:.:.|..:  :...:..:.||......:  :|:||||||....
Human   422 GATEEKGKT-SEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTS 485

  Fly   240 -----ILYGGTYRTFQFGIIIFGLSSCAGL---SVCTNVTFYMDWIW 278
                 .|.|.|    .:|      |.||..   .|..||..:.|||:
Human   486 KNNIWWLIGDT----SWG------SGCAKAYRPGVYGNVMVFTDWIY 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 61/239 (26%)
Tryp_SPc 57..277 CDD:238113 61/239 (26%)
TMPRSS2NP_001128571.1 DUF3824 <44..91 CDD:289625
LDLa 150..185 CDD:238060
SRCR_2 190..283 CDD:292133
Tryp_SPc 292..521 CDD:214473 61/239 (26%)
Tryp_SPc 293..524 CDD:238113 63/242 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.