DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and LOC683849

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_003749780.1 Gene:LOC683849 / 683849 RGDID:1597830 Length:246 Species:Rattus norvegicus


Alignment Length:230 Identity:62/230 - (26%)
Similarity:106/230 - (46%) Gaps:27/230 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PWIVSVIVNGKAKCSGSLINHRFVLTAAHCVFREAMQVHLGDFDAWNPGQNCSSGARLSNAYCVR 121
            |:.|| :.:|...|.|||||.::|::|||| ::..:||.||:.:.     |...|    |...|.
  Rat    36 PYQVS-LNSGYHFCGGSLINDQWVVSAAHC-YKSRIQVRLGEHNI-----NVLEG----NEQFVN 89

  Fly   122 IDKKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAIDRFQLTVWGTTAEDFR 186
            ..|.|.|..|.: :....||.|:::...|:.:..|..:. |.:....|..:..::.||.|.....
  Rat    90 AAKIIKHPNFDR-KTLNNDIMLIKLSSPVKLNARVATVA-LPSSCAPAGTQCLISGWGNTLSFGV 152

  Fly   187 SIPRVLKHSVGDRIDRELCTLKFQQQVDESQICVH--TETSHACKGDSGGPFSAKILYGGTYRTF 249
            :.|.:|:......:.:..|...:..::.::.:|..  .....:|:||||||    ::..|..:  
  Rat   153 NEPDLLQCLDAPLLPQADCEASYPGKITDNMVCAGFLEGGKDSCQGDSGGP----VVCNGELQ-- 211

  Fly   250 QFGIIIFGLSSCA---GLSVCTNVTFYMDWIWDAL 281
              ||:.:|. .||   ...|.|.|..|:|||.|.:
  Rat   212 --GIVSWGY-GCALPDNPGVYTKVCNYVDWIEDTI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 59/224 (26%)
Tryp_SPc 57..277 CDD:238113 59/224 (26%)
LOC683849XP_003749780.1 Tryp_SPc 23..239 CDD:214473 59/224 (26%)
Tryp_SPc 24..242 CDD:238113 61/227 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.