DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and 2210010C04Rik

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_075822.3 Gene:2210010C04Rik / 67373 MGIID:1914623 Length:247 Species:Mus musculus


Alignment Length:232 Identity:63/232 - (27%)
Similarity:106/232 - (45%) Gaps:35/232 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 ANPWIVSVIVNGKAKCSGSLINHRFVLTAAHCVFREAMQVHLGD--FDAWNPGQNCSSGARLSNA 117
            |.|:.|| :.:|...|.|||||.::|::|||| ::..:||.||:  .||...|:.....|::   
Mouse    35 ALPYQVS-LNSGYHFCGGSLINSQWVVSAAHC-YKSRIQVRLGEHNIDALEGGEQFIDAAKI--- 94

  Fly   118 YCVRIDKKIVHAGFGKIQAQQY--DIGLLRMQHAVQYSDFVRPICLLINEPVAAIDRFQLTVWGT 180
                    |.|..:   .|..|  ||.|::::.|...:..|..:.|..:.|.|. .|..::.||.
Mouse    95 --------IRHPNY---NANTYNNDIMLIKLKTAATLNSRVSTVALPRSCPSAG-TRCLVSGWGN 147

  Fly   181 TAEDFRSIPRVLKHSVGDRIDRELCTLKFQQQVDESQICVH--TETSHACKGDSGGPFSAKILYG 243
            |.....:.|.:|:......:....||..:..::..:..|:.  .....:|:||||||    ::..
Mouse   148 TLSSGTNYPSLLQCLDAPVLSDSSCTSSYPGKITSNMFCLGFLEGGKDSCQGDSGGP----VVCN 208

  Fly   244 GTYRTFQFGIIIFGLSSCAGL---SVCTNVTFYMDWI 277
            |..:    |::.:|. .||..   .|.|.|..|::||
Mouse   209 GQLQ----GVVSWGY-GCAQRGKPGVYTKVCKYVNWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 60/228 (26%)
Tryp_SPc 57..277 CDD:238113 60/228 (26%)
2210010C04RikNP_075822.3 Tryp_SPc 24..240 CDD:214473 61/230 (27%)
Tryp_SPc 25..243 CDD:238113 63/232 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.