DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and TMPRSS3

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_076927.1 Gene:TMPRSS3 / 64699 HGNCID:11877 Length:454 Species:Homo sapiens


Alignment Length:288 Identity:71/288 - (24%)
Similarity:119/288 - (41%) Gaps:56/288 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 REGSA-----FLLDAECGRSLPTNAKLTWWNYFDSSTDIQANPWIVSVIVNGKAKCSGSLINHRF 79
            |||.|     .|....||.....::::...|    .:.:...||..|:...|...|.||:|...:
Human   191 REGCASGHVVTLQCTACGHRRGYSSRIVGGN----MSLLSQWPWQASLQFQGYHLCGGSVITPLW 251

  Fly    80 VLTAAHCVFREAMQVHLGDFDAWNPGQ---NCSSGARLSNAYCVRIDKKIVHAGFGKIQAQQYDI 141
            ::||||||           :|.:.|..   .....:.|.|.....:.:|||:....|.:....||
Human   252 IITAAHCV-----------YDLYLPKSWTIQVGLVSLLDNPAPSHLVEKIVYHSKYKPKRLGNDI 305

  Fly   142 GLLRMQHAVQYSDFVRPICLLINEPVAAIDRFQ------LTVWGTTAEDFRSIPRVLKHSVGDRI 200
            .|:::...:.:::.::|:||..:|     :.|.      .:.||.|.:.......||.|:....|
Human   306 ALMKLAGPLTFNEMIQPVCLPNSE-----ENFPDGKVCWTSGWGATEDGAGDASPVLNHAAVPLI 365

  Fly   201 DRELCTLK--FQQQVDESQICVHTETS--HACKGDSGGPFSAK-----ILYGGTYRTFQFGIIIF 256
            ..::|..:  :...:..|.:|....|.  .:|:||||||...:     .|.|.|    .|||   
Human   366 SNKICNHRDVYGGIISPSMLCAGYLTGGVDSCQGDSGGPLVCQERRLWKLVGAT----SFGI--- 423

  Fly   257 GLSSCAGLS---VCTNVTFYMDWIWDAL 281
               .||.::   |.|.||.::|||.:.:
Human   424 ---GCAEVNKPGVYTRVTSFLDWIHEQM 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 61/240 (25%)
Tryp_SPc 57..277 CDD:238113 61/240 (25%)
TMPRSS3NP_076927.1 LDLa 74..107 CDD:238060
SRCR_2 112..210 CDD:292133 7/18 (39%)
Tryp_SPc 216..444 CDD:214473 62/257 (24%)
Tryp_SPc 217..447 CDD:238113 64/259 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.