DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and Tmprss11d

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001028824.2 Gene:Tmprss11d / 64565 RGDID:620654 Length:417 Species:Rattus norvegicus


Alignment Length:283 Identity:78/283 - (27%)
Similarity:120/283 - (42%) Gaps:69/283 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LLDAECGRSLP-------------TNAKLTWWNYFDSSTDIQANPWIVSVIVNGKAKCSGSLINH 77
            :|..||| :.|             |.|:...|            ||.||:.:|....|.|:||::
  Rat   167 VLTQECG-ARPDLITLSEERIIGGTQAETGDW------------PWQVSLQLNNVHHCGGTLISN 218

  Fly    78 RFVLTAAHCVFREAMQVHLGDFDAWNPGQ-NCSSG-ARLSNAYCVRIDKKIVHAGFGKIQAQQYD 140
            .:||||||| ||...          ||.| ..:.| :.:|....||:...:.||.:..| .:..|
  Rat   219 LWVLTAAHC-FRSYS----------NPQQWTATFGVSTISPRLRVRVRAILAHAEYNSI-TRDND 271

  Fly   141 IGLLRMQHAVQYSDFVRPICL------LINEPVAAIDRFQLTVWGTTAEDFRSIPRVLKHSVGDR 199
            |.::::...|.::..:..:||      :|.:.||.:     |.||:......::..:.:..|  |
  Rat   272 IAVVQLDRPVTFTRNIHRVCLPAATQNIIPDSVAYV-----TGWGSLTYGGNTVTNLQQGEV--R 329

  Fly   200 I-DRELCT--LKFQQQVDESQIC--VHTETSHACKGDSGGPFSAKILYGGTYRT-FQFGIIIFGL 258
            | ..|:|.  ..:...|....:|  |.:....||:||||||    ::...|.|. |..||:.:|.
  Rat   330 IVSSEVCNEPAGYGGSVLPGMLCAGVRSGAVDACQGDSGGP----LVQEDTRRLWFVVGIVSWGY 390

  Fly   259 SSCAGL----SVCTNVTFYMDWI 277
            .  .||    .|.|.||.|.:||
  Rat   391 Q--CGLPNKPGVYTRVTAYRNWI 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 68/237 (29%)
Tryp_SPc 57..277 CDD:238113 68/237 (29%)
Tmprss11dNP_001028824.2 SEA 48..150 CDD:396113
Tryp_SPc 186..414 CDD:238113 73/263 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.