DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and zgc:123295

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:299 Identity:86/299 - (28%)
Similarity:130/299 - (43%) Gaps:68/299 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VIAALLILFASLFLGSREGSAFLLDAECGRSLPTNAKL---------TWWNYFDSSTDIQANPWI 59
            |:.|||:..|        ||...|:. |||: |.|.|:         :|             ||.
Zfish     9 VVGALLVNIA--------GSLCQLNV-CGRA-PLNTKIVGGQNAGAGSW-------------PWQ 50

  Fly    60 VSV--IVNGKAKCSGSLINHRFVLTAAHCVFREA---MQVHLGDFDAWNPGQNCSSGARLSNAYC 119
            ||:  ...|...|.|||||..:||:|||| |:::   :.|.|        |....||   ||.| 
Zfish    51 VSLQSPTYGGHFCGGSLINKDWVLSAAHC-FQDSIGTIMVKL--------GLQSQSG---SNPY- 102

  Fly   120 VRIDKKIV----HAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICL-LINEPVAAIDRFQLTVWG 179
             :|.|.:|    |..:.. .:...||.|:::..:|.::|::.|:|| ......||.....:|.||
Zfish   103 -QITKTVVQVINHPNYNN-PSNDNDIALVKLDSSVTFNDYIEPVCLAAAGNTYAAGTLSWVTGWG 165

  Fly   180 TTAEDFRSIPRVLKHSVGDRIDRELCTLKFQQQVDESQIC---VHTETSHACKGDSGGPFSAKIL 241
            ..:.....||.:|:......:....|...:..::..:.||   :......:|:||||||..::  
Zfish   166 KLSSAANQIPDILQEVEIPIVSHSDCKRAYPGEITSNMICAGLLDQGGKDSCQGDSGGPMVSR-- 228

  Fly   242 YGGTYRTFQFGIIIFGLSSCA--GL-SVCTNVTFYMDWI 277
             .|: :..|.||:.|| ..||  |. .|...|:.|.|||
Zfish   229 -NGS-QWIQSGIVSFG-RGCAEPGYPGVYARVSQYQDWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 69/235 (29%)
Tryp_SPc 57..277 CDD:238113 69/235 (29%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 71/261 (27%)
Tryp_SPc 36..264 CDD:238113 70/260 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.