DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and zgc:123217

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001032480.1 Gene:zgc:123217 / 641414 ZFINID:ZDB-GENE-051113-188 Length:326 Species:Danio rerio


Alignment Length:290 Identity:82/290 - (28%)
Similarity:126/290 - (43%) Gaps:44/290 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLILFASLFLGSREGSAFLLDAECGRSLPTNAKLTWWNYFDSSTDIQAN--PWIVSVIVNGKAKC 70
            :|:|.:::.:.|.:.|......|||.: |.|.::.      ..||..|.  ||.||:..|.:..|
Zfish     5 VLLLSSAVIMLSTQDSNAQTTYECGVA-PLNTRIV------GGTDAPAGSWPWQVSIHYNNRHIC 62

  Fly    71 SGSLINHRFVLTAAHCVFREAMQV---HLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIVHAGFG 132
            .|:||:.::|:|||||:....:.|   :||       .|..|:.....|...|.|...|.|..|.
Zfish    63 GGTLIHSQWVMTAAHCIINTNINVWTLYLG-------RQTQSTSVANPNEVKVGIQSIIDHPSFN 120

  Fly   133 KIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAIDRFQ------LTVWGTTAED-FRSIPR 190
            . .....||.|:::...|.:|.::|||||..|..:     |.      .|.||...:| ....|:
Zfish   121 N-SLLNNDISLMKLSQPVNFSLYIRPICLAANNSI-----FYNGTSCWATGWGNIGKDQALPAPQ 179

  Fly   191 VLKHSVGDRIDRELCTLKFQQ----QVDESQICVHTETSHACKGDSGGPFSAKILYGGTYRTFQF 251
            .|:......:...||:.:::.    .:....||........|:|||||||..|  .|..:  .|.
Zfish   180 TLQQVQIPVVANSLCSTEYESVNNATITPQMICAGKANKGTCQGDSGGPFQCK--QGSVW--IQA 240

  Fly   252 GIIIFGLSS-CA-GL--SVCTNVTFYMDWI 277
            ||..:|.|: || |.  .|.:.|:.:..||
Zfish   241 GITSYGTSAGCAVGAYPDVYSRVSEFQSWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 68/237 (29%)
Tryp_SPc 57..277 CDD:238113 68/237 (29%)
zgc:123217NP_001032480.1 Tryp_SPc 36..270 CDD:214473 71/256 (28%)
Tryp_SPc 37..273 CDD:238113 73/257 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.