DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and c1s

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_002941253.2 Gene:c1s / 613055 XenbaseID:XB-GENE-995410 Length:691 Species:Xenopus tropicalis


Alignment Length:260 Identity:64/260 - (24%)
Similarity:102/260 - (39%) Gaps:70/260 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PWIV---SVIVNGKAKCSGSLINHRFVLTAAHCVFREAMQVHLGDFDAWNPGQNCSSGARLSNAY 118
            ||::   .:.:.|     ||||:.|:||||||.|.::......|....:.|..|..|..:...| 
 Frog   449 PWMIQFTDIELGG-----GSLISDRWVLTAAHVVNKKIFPTMFGGVMKFFPNTNLQSQEKRLQA- 507

  Fly   119 CVRIDKKIVHAGFGKIQAQQ------YDIGLLRMQHAVQYSDFVRPICL-------LINEPVAAI 170
                .|.|:|..:...:..:      .||.|:::...|:....:.||||       ::|| ||.|
 Frog   508 ----KKIIIHPLYQDNEDTEGQSNFDNDIALVQLTKKVKLGSCISPICLPRRGLAPVVNE-VATI 567

  Fly   171 DRFQLTVWGTTAE-------DFRSIP----RVLKHSVGDRIDRELCTLKFQQQVDESQICVHTET 224
                 ..||.|.:       .|.||.    ...|.:.|.:           .....:.:|..::.
 Frog   568 -----AGWGKTEKRESAVNLQFASISLSSMDKCKKATGGK-----------GYFTPNMLCAGSDV 616

  Fly   225 -SHACKGDSGGPF-------SAKILYGGTYRTFQFGIIIFGLSSCAGLSVCTNVTFYMDWIWDAL 281
             ..:|.||||||.       |:|:        :..||:.:|...|....:.|.|..|:|||.:.:
 Frog   617 GKDSCNGDSGGPLMFTDPQDSSKM--------YMAGIVSWGPRDCGTYGLYTKVDNYLDWIEETI 673

  Fly   282  281
             Frog   674  673

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 62/254 (24%)
Tryp_SPc 57..277 CDD:238113 62/254 (24%)
c1sXP_002941253.2 CUB 21..131 CDD:238001
FXa_inhibition 145..173 CDD:405372
CUB 177..288 CDD:238001
PHA02927 301..>436 CDD:222943
Tryp_SPc 436..669 CDD:214473 62/254 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.