DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG18735

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster


Alignment Length:266 Identity:64/266 - (24%)
Similarity:113/266 - (42%) Gaps:41/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DAECGRSLPTNAKLTWWNYFDSSTDIQANPWIVSVIVNGKAKCSGSLINHRFVLTAAHCV---FR 89
            :..|| ::.|..::..    ...|::...||::.::..|...|..||:|.::.|||||||   :.
  Fly    71 ECSCG-NINTRHRIVG----GQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYH 130

  Fly    90 EAMQVHLGDFDAWNPGQNCSSGARLSNAYCV--RIDKKIVHAGFGKIQAQQY--DIGLLRMQHAV 150
            ..:.|.|.:.:..:           |:...|  |:.:.::|.   |...:.:  ||.|:|....|
  Fly   131 RLITVRLLEHNRQD-----------SHVKIVDRRVSRVLIHP---KYSTRNFDSDIALIRFNEPV 181

  Fly   151 QYSDFVRPICLLINEPVAAIDRFQLTVWGTTAEDFRSIPRVLKHSVGDRIDRELC--TLKFQQQV 213
            :....:.|:|:.......|.....:|.||..:|. ..|...|:......:.:|.|  :...:.::
  Fly   182 RLGIDMHPVCMPTPSENYAGQTAVVTGWGALSEG-GPISDTLQEVEVPILSQEECRNSNYGESKI 245

  Fly   214 DESQIC---VHTETSHACKGDSGGPFSAKILYGGTYRTFQF-GIIIFGLSSCA---GLSVCTNVT 271
            .::.||   |......:|:||||||....    |:...:|. ||:.:| ..||   ...|.|.|.
  Fly   246 TDNMICAGYVEQGGKDSCQGDSGGPMHVL----GSGDAYQLAGIVSWG-EGCAKPNAPGVYTRVG 305

  Fly   272 FYMDWI 277
            .:.|||
  Fly   306 SFNDWI 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 58/235 (25%)
Tryp_SPc 57..277 CDD:238113 58/235 (25%)
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 59/252 (23%)
Tryp_SPc 83..314 CDD:238113 61/253 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.