DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG34458

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:236 Identity:58/236 - (24%)
Similarity:102/236 - (43%) Gaps:43/236 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PWIVSVIVNGKAKCSGSLINHRFVLTAAHCVFREAMQVHLGDFDAWNPGQ--------NCSSGAR 113
            |..||:.:||:..|.||||:...::|||||...:            ||||        :.|:|  
  Fly    44 PHQVSLQLNGRHHCGGSLISDTMIVTAAHCTMGQ------------NPGQMKAIVGTNDLSAG-- 94

  Fly   114 LSNAYCVRIDKKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAIDRF-QLTV 177
              |.....|.:.|:|..:.. |:|.:|:.|:::...|.....|:.|.|..::...|.|.. .::.
  Fly    95 --NGQTFNIAQFIIHPRYNP-QSQDFDMSLIKLSSPVPMGGAVQTIQLADSDSNYAADTMAMISG 156

  Fly   178 WGTTAEDFRSIPRVLKHSVGDRIDRELCTLKFQQQVDESQICVHTETSH--ACKGDSGGPFS--A 238
            :|...::.: :|..||.:......|:.|..:....:.:..:|....:..  :|:||||||.:  .
  Fly   157 FGAINQNLQ-LPNRLKFAQVQLWSRDYCNSQNIPGLTDRMVCAGHPSGQVSSCQGDSGGPLTVDG 220

  Fly   239 KILYGGTYRTFQFGIII--FGLSSCAGLSVCTNVTFYMDWI 277
            |:          ||::.  ||..:....::.|.|.....||
  Fly   221 KL----------FGVVSWGFGCGAKGRPAMYTYVGALRSWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 56/234 (24%)
Tryp_SPc 57..277 CDD:238113 56/234 (24%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 56/234 (24%)
Tryp_SPc 32..254 CDD:238113 58/236 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.