DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG34409

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:262 Identity:70/262 - (26%)
Similarity:108/262 - (41%) Gaps:63/262 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PWIVSVIVNGKA------KCSGSLINHRFVLTAAHCVFR-----EAMQVHLGDFDAWNPGQNCSS 110
            ||:..:....::      :||||||:...::||||||..     |...|.||..|...|      
  Fly   262 PWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCVVNLVSDLELSHVRLGSQDGATP------ 320

  Fly   111 GARLSNAYCVRIDKKIVHAGFGKIQAQQY--DIGLLRMQHAVQYSDFVRPICLLINEPVAAIDRF 173
                     ..|::.|||..:.:   .:|  ||.|||:...   :....||||..|.|:...:|.
  Fly   321 ---------FAIEQVIVHPNYDQ---PKYANDIALLRINST---NGTFTPICLPFNGPITLGNRL 370

  Fly   174 --QLTV---WGTTAEDFRSIPRVLKHSVGDR------IDRELCTL-------KFQQQ--VDESQI 218
              |:.|   |...:.:..|.......:.|.|      ::...|.:       .|||.  :..:.:
  Fly   371 IGQIGVAAGWSIGSTENNSSMDPSNSTAGVRFIRLPIVNTTSCAIAYASLSENFQQPIVITPNHL 435

  Fly   219 CVH-TETSHACKGDSGGPF---SAKILYGGTYRTFQFGIIIFGLSSCAGLS----VCTNVTFYMD 275
            |.. ...:..|:|||||||   ....::|.:.|....||:.||.:.| |::    |.|.|:.:.|
  Fly   436 CAQGMPMNDVCRGDSGGPFMDDGTSGVFGTSGRYTIIGIVAFGPTLC-GVTTIPGVYTLVSSFSD 499

  Fly   276 WI 277
            ||
  Fly   500 WI 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 68/260 (26%)
Tryp_SPc 57..277 CDD:238113 68/260 (26%)
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 68/260 (26%)
Tryp_SPc 252..501 CDD:238113 68/260 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.