DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG34436

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster


Alignment Length:276 Identity:84/276 - (30%)
Similarity:127/276 - (46%) Gaps:40/276 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SREGSAFLLDAECGRSLPTNAKLTWWNYFDSSTDIQANPWIVSVIVNGKAKCSGSLINHRFVLTA 83
            :.:|||.|||..|...    ::|       |:..|.:.||:..|::..|. |||:||:..||:|:
  Fly    15 ANQGSAQLLDQNCAEV----SRL-------SNDIIFSRPWMALVLLPNKT-CSGALIHKYFVITS 67

  Fly    84 AHCVF-REAMQVHLGDFDAWNPG--QNCSSGARLSNAYCVRIDKKIVHAGFGKIQAQQYDIGLLR 145
            |.||| :|...|.||........  ...|....:.:||..|..:|   :.|      ::||.||.
  Fly    68 ASCVFNQERAIVRLGQLSIKQEHIVSYSSDDYHVQSAYIHRFYEK---SNF------EHDIALLE 123

  Fly   146 MQHAVQYSDFVRPICLLINEPVAAID-----RFQLTVWGTTAEDFRSIPRVLKHSVGDRIDRELC 205
            :|:.|.|...:|||||.:::  :.||     |::...||.   |.:.|....|.|....|.:..|
  Fly   124 LQNDVLYKAHIRPICLWLDK--SDIDTQMFKRYETFRWGI---DEKYILPAAKTSKIKHISQVKC 183

  Fly   206 TLKFQQQVDESQICVHTETSHACKGDSGGPFSAKILYGGTYRTFQFGIIIFGLS-SCAGLSVCTN 269
            ...|:.....|.||...:....|. ::|.|...||.|....|...|||..:|.| :|    :.|:
  Fly   184 ENAFKLYPQNSHICAGYKNKSKCV-ETGSPLFKKIRYYTKIRYTLFGIQSYGESRTC----LYTD 243

  Fly   270 VTFYMDWIWDALVNLS 285
            ||.|:|||...:.|::
  Fly   244 VTKYIDWIMGVIQNVN 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 71/228 (31%)
Tryp_SPc 57..277 CDD:238113 71/228 (31%)
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 72/231 (31%)
Tryp_SPc 40..251 CDD:214473 71/230 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25741
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.