DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and si:dkeyp-93a5.3

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_021326347.1 Gene:si:dkeyp-93a5.3 / 571565 ZFINID:ZDB-GENE-131127-100 Length:328 Species:Danio rerio


Alignment Length:323 Identity:85/323 - (26%)
Similarity:123/323 - (38%) Gaps:99/323 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KKVIAALLILFASLFLGSREGSAFLLDAECGRSLPT---------NAKLTWWNYFDSSTDIQANP 57
            |..:..||:::....|.:.:        .|||..||         ||....|            |
Zfish     4 KTCVTLLLLMYVRDSLSNLQ--------VCGRPNPTLNPRIVGGVNATHGAW------------P 48

  Fly    58 WIVSVIVNGKAKCSGSLINHRFVLTAAHCVFRE---AMQVHLGDFDAWNPGQNCSSGARLSNAYC 119
            |:||:.......|.|||||:::|||||||:..:   ::.|:||.:.::....|..|         
Zfish    49 WMVSLQGRYGHFCGGSLINNQWVLTAAHCIVDQTPSSIIVYLGKWRSYVADVNSIS--------- 104

  Fly   120 VRIDKKIV-HAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLL---------INEPVAAIDRFQ 174
             |..:.|: |..:..| .:..||.||::...|||:|:::||||.         .|..||.     
Zfish   105 -RTIRHIIPHPSYSNI-TKDNDIALLQLTSTVQYTDYIKPICLADENSNFPRGTNSWVAG----- 162

  Fly   175 LTVWG-------------TTAEDFRSIPRVLKHSVGDRIDREL-------CTLKFQQQVDESQIC 219
               ||             ||.    |:|  |.|. |...:.||       |......::..:.||
Zfish   163 ---WGDIGVLGTGGIRGRTTV----SVP--LPHP-GILQEAELKVYSNADCNNICHGRITPNMIC 217

  Fly   220 VHTETSHAC--KGDSGGPFSAKILYGGTYRTFQFGIIIFGLSSCAGLS---VCTNVTFYMDWI 277
            ..|......  .||||||...|...     ..|.|::..|. .||..:   |...|:.|..||
Zfish   218 AGTRPGGKATFSGDSGGPLMTKCSV-----WVQAGVLSHGY-GCAQPNLPEVFIRVSEYKQWI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 71/257 (28%)
Tryp_SPc 57..277 CDD:238113 71/257 (28%)
si:dkeyp-93a5.3XP_021326347.1 Tryp_SPc 36..274 CDD:238113 74/281 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.