DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and AgaP_AGAP012505

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_001688570.1 Gene:AgaP_AGAP012505 / 5668379 VectorBaseID:AGAP012505 Length:283 Species:Anopheles gambiae


Alignment Length:153 Identity:37/153 - (24%)
Similarity:66/153 - (43%) Gaps:40/153 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 FLLDAECGR----SLPTNAKLTWWNYFDSSTDIQANPWIVSVIVNGKAKCSGSLINHRFVLTAAH 85
            |..|.:.|.    |:..|.::.|.:  |.:|..               .|.|.||:.|.|:::|.
Mosquito   152 FTTDQQNGSSHAVSIAYNVEIGWQD--DRNTTY---------------ACYGYLISTRGVVSSAS 199

  Fly    86 CVFREA---MQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIVHAGFGKIQAQQYDIGLLRMQ 147
            |:...|   ..|.:|..|:            |.|:..|.|:|.|:|..:.| :..:::|.:::::
Mosquito   200 CLSERADLPNIVRIGGIDS------------LDNSRVVPIEKVIIHPDYNK-ETLEHNIAIVKLE 251

  Fly   148 HAVQYSDFVRPICL---LINEPV 167
            ..|..|:.|.|.||   :.:.||
Mosquito   252 STVDPSENVFPTCLWQNITHSPV 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 29/117 (25%)
Tryp_SPc 57..277 CDD:238113 29/117 (25%)
AgaP_AGAP012505XP_001688570.1 Tryp_SPc 184..>265 CDD:304450 25/93 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.