powered by:
Protein Alignment CG14227 and AgaP_AGAP012035
DIOPT Version :9
| Sequence 1: | NP_608345.2 |
Gene: | CG14227 / 32978 |
FlyBaseID: | FBgn0031058 |
Length: | 286 |
Species: | Drosophila melanogaster |
| Sequence 2: | XP_001689264.1 |
Gene: | AgaP_AGAP012035 / 5668016 |
VectorBaseID: | AGAP012035 |
Length: | 197 |
Species: | Anopheles gambiae |
| Alignment Length: | 36 |
Identity: | 11/36 - (30%) |
| Similarity: | 15/36 - (41%) |
Gaps: | 7/36 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 26 LLDAECGRSLPTNAKLTWWN-YFDSSTDIQANPWIV 60
:|.|.||...|: || :.|...|...:.|.|
Mosquito 166 VLPARCGEQRPS------WNVWSDIEDDDNIHVWAV 195
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG14227 | NP_608345.2 |
Tryp_SPc |
57..277 |
CDD:214473 |
2/4 (50%) |
| Tryp_SPc |
57..277 |
CDD:238113 |
2/4 (50%) |
| AgaP_AGAP012035 | XP_001689264.1 |
CLIP |
39..95 |
CDD:288855 |
|
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.
