DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and PRSS8

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens


Alignment Length:312 Identity:91/312 - (29%)
Similarity:136/312 - (43%) Gaps:67/312 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAALLILFASLFLG------SREGSAFLLDAECGRSLPTNAKLTWWNYFDSSTDIQANPWIVSVI 63
            :.|:.||   |:||      ..||:    :|.||  :...|::|.    .||......||.||:.
Human    12 LGAVAIL---LYLGLLRSGTGAEGA----EAPCG--VAPQARITG----GSSAVAGQWPWQVSIT 63

  Fly    64 VNGKAKCSGSLINHRFVLTAAHCV----FREAMQVHLG--DFDAWNPGQNCSSGARLSNAYCVRI 122
            ..|...|.|||::.::||:||||.    .:||.:|.||  ..|::      |..|::|..     
Human    64 YEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSY------SEDAKVSTL----- 117

  Fly   123 DKKIV-HAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAID-----RFQLTVWGTT 181
             |.|: |..:.: :..|.||.||::...:.:|.::|||||    |.|...     ...:|.||..
Human   118 -KDIIPHPSYLQ-EGSQGDIALLQLSRPITFSRYIRPICL----PAANASFPNGLHCTVTGWGHV 176

  Fly   182 AEDFRSI-PRVLKHSVGDRIDRELCTLKFQ--------QQVDESQICV-HTE-TSHACKGDSGGP 235
            |.....: |:.|:......|.||.|...:.        ..|.|..:|. :.| ...||:||||||
Human   177 APSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGP 241

  Fly   236 FSAKILYGGTYRTFQFGIIIFGLSSCAGLS---VCTNVTFYMDWIWDALVNL 284
            .|..: .|..|.|   ||:.:| .:|...:   |.|..:.|..||...:..|
Human   242 LSCPV-EGLWYLT---GIVSWG-DACGARNRPGVYTLASSYASWIQSKVTEL 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 73/245 (30%)
Tryp_SPc 57..277 CDD:238113 73/245 (30%)
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 76/262 (29%)
Tryp_SPc 45..284 CDD:238113 78/264 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.