DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and zgc:100868

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_005164187.1 Gene:zgc:100868 / 554458 ZFINID:ZDB-GENE-040801-33 Length:654 Species:Danio rerio


Alignment Length:300 Identity:86/300 - (28%)
Similarity:135/300 - (45%) Gaps:64/300 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAALLILFASLFLGSREGSAFLLDAECGRSLPTNAKLTWWNYFDSSTDIQANPWIVSVIVNGKAK 69
            |..:.|:..:|.:....|....||. || :.|.|:::..    ..:..:.|.||.||:..:|...
Zfish     3 IMKIHIVGVALTIALLTGCDAQLDV-CG-TAPLNSRIVG----GQNAPVGAWPWQVSLQRDGSHF 61

  Fly    70 CSGSLINHRFVLTAAHCV---FREAMQVHLG-----DFDAWNPGQNCSSGARLSNAYCVRIDKKI 126
            |.|||||::::||||||.   ....:.|:||     .|:::      |..:.:||.        |
Zfish    62 CGGSLINNQWILTAAHCFPNPSTTGLLVYLGLQKLASFESY------SMSSAVSNI--------I 112

  Fly   127 VHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAIDR-------FQLTVWGTTAED 184
            .|..:.. ..:..||.||::...|.:|:::|||||      ||.|.       ..:|.||.||..
Zfish   113 KHPNYNS-DTEDNDITLLQLASTVSFSNYIRPICL------AASDSTFFNGTLVWITGWGNTATG 170

  Fly   185 FRSIP------RVLKHSVGDRIDRELCTLKF-QQQVDESQIC--VHTETSHACKGDSGGPFSAKI 240
            . |:|      .|....||:|    .|...: ..::.::.:|  :......:|:||||||..:| 
Zfish   171 V-SLPSPGTLQEVQVPIVGNR----KCNCLYGVSKITDNMVCAGLLQGGKDSCQGDSGGPMVSK- 229

  Fly   241 LYGGTYRTFQFGIIIFGLSSCAGLS---VCTNVTFYMDWI 277
             .|..:  .|.||:.|| :.||..:   |.|.|:.|..||
Zfish   230 -QGSVW--IQSGIVSFG-TGCAQPNFPGVYTRVSKYQSWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 73/246 (30%)
Tryp_SPc 57..277 CDD:238113 73/246 (30%)
zgc:100868XP_005164187.1 Tryp_SPc 36..265 CDD:214473 74/263 (28%)
Tryp_SPc 37..267 CDD:238113 75/263 (29%)
Tryp_SPc 331..509 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.