DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and cela1.2

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001011493.1 Gene:cela1.2 / 496993 XenbaseID:XB-GENE-5739190 Length:265 Species:Xenopus tropicalis


Alignment Length:274 Identity:73/274 - (26%)
Similarity:126/274 - (45%) Gaps:39/274 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SAFLLDAECG---RSLPTNAKLTWWNYFDSSTDIQAN--PWIVSV-IVNGKA---KCSGSLINHR 78
            :||:|..:|.   |.:..:.::.      ..|::|.|  ||.||: .::|.:   .|.||||...
 Frog     8 AAFVLCGQCSNDIRLIEDHERVI------GGTEVQRNSWPWQVSLQYLSGGSWYHTCGGSLIRAN 66

  Fly    79 FVLTAAHCVFRE-AMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIVHAGFGKIQ-AQQYDI 141
            .||||||||.|. :.:|.:||.:.:   ||..:...:|      :.:.:.||.:.... |..|||
 Frog    67 RVLTAAHCVDRAVSYRVVVGDHNIY---QNDGTEQYIS------VSRIVKHANWNPNNIAAGYDI 122

  Fly   142 GLLRMQHAVQYSDFVRPICLLINEPVAAID-RFQLTVWGTTAEDFRSIPRVLKHSVGDRIDRELC 205
            .:|.:..:...:.:|:...|..:..|.|.: ...:|.||.|:.: .::..||:.:....|....|
 Frog   123 SILHLSSSATLNSYVKLAQLPADNVVLAHNYNCVVTGWGKTSNN-GNLASVLQQAPLPVIAHSTC 186

  Fly   206 T--LKFQQQVDESQICVHTE-TSHACKGDSGGPFSAKILYGGTYRTFQFGIIIF----GLSSCAG 263
            :  ..:...|..:.:|...: ....|:||||||.:..:  .|.|:.  .|:..|    |.|:...
 Frog   187 SSGSYWGSTVKSTMVCAGGDGVRSGCQGDSGGPLNCPV--NGVYQV--HGVTSFVSSSGCSTYLK 247

  Fly   264 LSVCTNVTFYMDWI 277
            .:|.|.|:.|:.||
 Frog   248 PTVFTRVSAYIGWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 63/233 (27%)
Tryp_SPc 57..277 CDD:238113 63/233 (27%)
cela1.2NP_001011493.1 Tryp_SPc 29..264 CDD:238113 68/253 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.