DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and proz

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001116189.1 Gene:proz / 496781 XenbaseID:XB-GENE-971425 Length:416 Species:Xenopus tropicalis


Alignment Length:258 Identity:51/258 - (19%)
Similarity:100/258 - (38%) Gaps:51/258 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LGSREGSAFLLDA-ECGRSLPTNAKLTWWNYFDSSTDIQAN--PWIVSVIVNGKAK-CSGSLINH 77
            ||:.|.|....|. .||:.|.....:|     .:...:||:  ||.|.|:.:.|.: |||.:::.
 Frog   160 LGADEKSCHPEDPFACGQILNLEVSIT-----KNRNHLQADIFPWQVPVLNSQKVQVCSGVVLSE 219

  Fly    78 RFVLTAAHCVFREAMQVHLGDFDAWNP-----GQNCSSGARLSNAYCVRIDKKIVHAGFGKIQAQ 137
            ..|||.|.|:            ..::|     |....||  |.....:|:..|.||..:.: :..
 Frog   220 SVVLTTASCI------------TMYDPYFVVAGVQQKSG--LGQRQMIRVKTKQVHMRYSE-ETG 269

  Fly   138 QYDIGLLRMQHAVQYSDFVRPICL----LINEPVAAIDRFQLTVWGTTAEDFRSIPRVLKHSVGD 198
            ..:|.||:::..:.:.:...|||:    .....:...:...::.|.:::|              :
 Frog   270 DNNIALLKLKEKIVFHNNSLPICIPQKDFAENVLVPFNTGLVSGWKSSSE--------------E 320

  Fly   199 RIDRELCTLKFQQQVDESQICVH----TETSHACKGDSGGPFSAKILYGGTYRTFQFGIIIFG 257
            ..|..:....:.:..:.:::|..    |:|:....|.|.....:::..||.......|:...|
 Frog   321 EADALIPIQFYTKYTNRTEVCEQSLNVTQTNRMFCGVSHEAIDSELSEGGHLAVQHNGVWFLG 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 40/215 (19%)
Tryp_SPc 57..277 CDD:238113 40/215 (19%)
prozNP_001116189.1 GLA 22..85 CDD:214503
EGF_CA 92..123 CDD:238011
FXa_inhibition 136..167 CDD:373209 3/6 (50%)
Tryp_SPc 197..414 CDD:389826 40/216 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.