DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and hgfa

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_005164799.1 Gene:hgfa / 493781 ZFINID:ZDB-GENE-041014-2 Length:712 Species:Danio rerio


Alignment Length:252 Identity:60/252 - (23%)
Similarity:93/252 - (36%) Gaps:76/252 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 WIVSVIVNGKAKCSGSLINHRFVLTAAHC-------VFREAMQV---HLGDFDAWNPGQNCSSGA 112
            |:||:....:..|.||||...:|||...|       :....:||   ||          |.|:|.
Zfish   491 WVVSIQKGNRHWCGGSLIREEWVLTDQQCFSTCVPDLSEYTVQVGLLHL----------NASAGT 545

  Fly   113 RLSNAYCVRIDKKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAIDRFQLTV 177
            :.         .:|.|...|   .:..::.||::......|:.||.:.|    |||.....:.|:
Zfish   546 QA---------LRIAHVVCG---PEGSNLALLKLTTPAPLSEHVRTVQL----PVAGCAVAEGTL 594

  Fly   178 -----WGTTAEDFRSIPRVLKHS-----VG-DRIDRELCTLKFQ--QQVDESQICVHTETSH-AC 228
                 ||.|        :...|.     || ..:..:.|:....  ..:.|::||...:... .|
Zfish   595 CLMYGWGDT--------KGTGHEGSLKMVGLPIVSNKRCSQSHNGILPITETKICAGGKRDQGVC 651

  Fly   229 KGDSGGPF-----SAKILYGGTYRTFQFGIIIFGLSSCAGL---SVCTNVTFYMDWI 277
            :.|.|||.     .:|::         .|:.|.| ..||..   :|..||.||.:||
Zfish   652 EKDYGGPLVCQEGESKVI---------VGVSING-RGCAVARRPAVFVNVAFYSEWI 698

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 58/250 (23%)
Tryp_SPc 57..277 CDD:238113 58/250 (23%)
hgfaXP_005164799.1 PAN_AP_HGF <50..107 CDD:238532
KR 111..192 CDD:238056
KR 195..275 CDD:214527
KR 287..367 CDD:214527
KR 374..451 CDD:214527
Tryp_SPc 476..698 CDD:214473 58/250 (23%)
Tryp_SPc 477..701 CDD:238113 60/252 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575863
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.