DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and AgaP_AGAP012502

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_001230484.2 Gene:AgaP_AGAP012502 / 4578454 VectorBaseID:AGAP012502 Length:829 Species:Anopheles gambiae


Alignment Length:225 Identity:57/225 - (25%)
Similarity:99/225 - (44%) Gaps:24/225 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 CSGSLINHRFVLTAAHCV-FREAMQ----VHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIVHA 129
            |.||||...|:||||||. .|:.:.    :.:||.:.::..::    |.:.....:|:.:..:: 
Mosquito    46 CGGSLIWANFILTAAHCTKDRDTLLPPDIIRIGDLNLYDDRED----ALVQERTIIRVIRHPLY- 105

  Fly   130 GFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAIDRFQLTVWGTTAEDFRSIPRVLKH 194
               ...:..|||.||.:...|.....|.|.||.:::.: ...:.:...|||:...:.....::|.
Mosquito   106 ---NTSSVFYDIALLMLNEKVNIYFEVMPTCLWLDDNI-PFSKVEAAGWGTSGFGYGKTNILIKA 166

  Fly   195 SVGDRIDRELCTLKFQQQVD------ESQICVHTETSHACKGDSGGPFSAKILYGGTYRTFQFGI 253
            .:....::: |...:.|...      |.|:|...:....|.||||||...|:::|.....|..|:
Mosquito   167 ELKLMANKD-CESYYSQVASVKNGLMEHQLCAWDKVMDTCPGDSGGPLQHKLIFGDYKVPFLVGV 230

  Fly   254 IIFGLSSCAGL--SVCTNVTFYMDWIWDAL 281
            ..||| ||...  .|...|:.:..||.:.|
Mosquito   231 TSFGL-SCGNSQPGVYVKVSKFGSWIVETL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 54/219 (25%)
Tryp_SPc 57..277 CDD:238113 54/219 (25%)
AgaP_AGAP012502XP_001230484.2 Tryp_SPc 19..258 CDD:238113 56/222 (25%)
Tryp_SPc 19..255 CDD:214473 54/219 (25%)
Tryp_SPc 325..>418 CDD:304450
Trypsin 621..823 CDD:278516
Tryp_SPc 629..826 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.