DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and cela1.6

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001003737.1 Gene:cela1.6 / 445282 ZFINID:ZDB-GENE-040808-55 Length:266 Species:Danio rerio


Alignment Length:242 Identity:64/242 - (26%)
Similarity:104/242 - (42%) Gaps:43/242 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PWIVSV-IVNGKA---KCSGSLINHRFVLTAAHCV-FREAMQVHLGDFDAWNPGQNCSSGARLSN 116
            ||.:|: .::|.:   .|.|:||...||||||||| .....:|.||:.|.:.. :.......:||
Zfish    42 PWQISLQYLSGGSYYHTCGGTLIKQNFVLTAAHCVDTSRTWRVVLGEHDIYKQ-EGREQYMTVSN 105

  Fly   117 AYCVRIDKKIVHAGFGKIQ-AQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAI----DRFQLT 176
            .|        :|..:.:.. |..|||.|||:......:.:|:   |....|...:    :...:|
Zfish   106 VY--------IHPNWNRNNVAAGYDIALLRLSSNASLNTYVQ---LGTLPPSGQVLPHNNACYIT 159

  Fly   177 VWGTTAEDFRSIPRVLKHSVGDRIDRELCTLK--FQQQVDESQICVHTETSHACKGDSGGPFSAK 239
            .||.|:.. .|:...||.:....:|...|:..  :...|..:.:|....:...|:||||||.:.:
Zfish   160 GWGLTSTG-GSLSAQLKQAYLPVVDYNTCSRGDWWGSTVKNTMVCAGGGSLSGCQGDSGGPLNCQ 223

  Fly   240 ILYGGTYRTFQFGIIIFGLSSCAGLSVC---------TNVTFYMDWI 277
            :  .|.|       ::.|::|....|.|         |.|:.|:.||
Zfish   224 V--SGQY-------VVHGVTSFVSSSGCNAYQKPTVFTRVSAYISWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 62/240 (26%)
Tryp_SPc 57..277 CDD:238113 62/240 (26%)
cela1.6NP_001003737.1 Tryp_SPc 30..264 CDD:238113 64/242 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.