DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG9733

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster


Alignment Length:263 Identity:85/263 - (32%)
Similarity:123/263 - (46%) Gaps:44/263 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 YFDSSTDIQANPWIVSVIV-----NG-KAKCSGSLINHRFVLTAAHC----VFREA---MQVHLG 97
            |....||:...||:|.:..     || ...|:|||||.|:|||||||    :.||.   :.|.||
  Fly   163 YDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCLTGRIEREVGTLVSVRLG 227

  Fly    98 DFDAWNPGQNCSSGARLSNAYCVRI--DKKIVHAGFG-KIQAQQYDIGLLRMQHAVQYSDFVRPI 159
            :.|. ....:|..|....:....|:  ::..||..:. |...|.:||||:||:..|:|||.::||
  Fly   228 EHDT-RTAVDCPPGGGSCSPEVQRLGFEEIRVHERYSEKASNQVHDIGLIRMERNVRYSDNIQPI 291

  Fly   160 CLLIN---EPVAAIDRFQLTVWGTTAEDFRSIPRVLKHSVG-DRIDRELCTLKFQQ---QVDESQ 217
            ||..:   |...:..:|.:..||.|.:..||   .:|..|. :.:|...|..:|.|   .::.:|
  Fly   292 CLPSSVGLESRQSGQQFTVAGWGRTLKMARS---AVKQKVTVNYVDPAKCRQRFSQIKVNLEPTQ 353

  Fly   218 ICVHTE-TSHACKGDSGGPFSAKILYGGTYRTFQF---GIIIFGLSSCAGL----SVCTNVTFYM 274
            :|...: ...:|.||||||..       .:|...:   ||:.||..  .||    .|.|||..|.
  Fly   354 LCAGGQFRKDSCDGDSGGPLM-------RFRDESWVLEGIVSFGYK--CGLKDWPGVYTNVAAYD 409

  Fly   275 DWI 277
            .||
  Fly   410 IWI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 80/250 (32%)
Tryp_SPc 57..277 CDD:238113 80/250 (32%)
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 83/261 (32%)
Tryp_SPc 162..415 CDD:238113 85/263 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.