DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG11843

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:228 Identity:68/228 - (29%)
Similarity:110/228 - (48%) Gaps:37/228 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 CSGSLINHRFVLTAAHCVFREAMQVH---LGDFDAWNPGQNCSSGARLSNAYCVRIDKKIVHAGF 131
            |.|.||:.|||||||||:..|..:|:   ||:.|..:..::.:....:...|       |.|.|:
  Fly    99 CGGVLISERFVLTAAHCLESERGEVNVVRLGELDFDSLDEDAAPRDYMVAGY-------IAHPGY 156

  Fly   132 GKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAIDRFQLTVWGTTAEDFRSIPRVLKHSV 196
            ...|. .:||||:::..||.:..:..|.||...:..:: |.|....||:|....:...::||..:
  Fly   157 EDPQF-YHDIGLVKLTEAVVFDLYKHPACLPFQDERSS-DSFIAVGWGSTGLALKPSAQLLKVKL 219

  Fly   197 GDRIDRELCTLKFQQQVDE--------SQICVHTETSH-ACKGDSGGPFSAKILYGGTYRTFQFG 252
             .|....:|.....:||:|        :|:||.:|.:. .|.||||||.   ::|   :|.:...
  Fly   220 -QRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGSEMAQDTCNGDSGGPL---LMY---HREYPCM 277

  Fly   253 IIIFGLSSCAGLS--------VCTNVTFYMDWI 277
            .::.|::| ||||        :.|.|..|:.||
  Fly   278 YVVVGITS-AGLSCGSPGIPGIYTRVYPYLGWI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 66/226 (29%)
Tryp_SPc 57..277 CDD:238113 66/226 (29%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 68/228 (30%)
Tryp_SPc 68..309 CDD:214473 66/226 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.