DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG11836

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:308 Identity:85/308 - (27%)
Similarity:131/308 - (42%) Gaps:63/308 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LFASLF-LGSREGSAFLL------------------DAECGRSLPTNAKLTWWNYFDSSTDIQAN 56
            ||.::| :.|...:||.|                  |.:||.|   |.::....  ...|.:...
  Fly    49 LFDTIFRISSGVSNAFGLSDTEDEVEYTENSSLKNCDCDCGFS---NEEIRIVG--GKPTGVNQY 108

  Fly    57 PWIVSVIVNGKAKCSGSLINHRFVLTAAHCV---FREAMQVHLGDFDAWNPGQNCSSGARLSNAY 118
            ||:..::.:||..|.|||:...:||:|||||   .:..::|..||.|     |..:|.   |.|.
  Fly   109 PWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFGDHD-----QEITSE---SQAI 165

  Fly   119 CVRIDKKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICL--LINEPVAAIDRFQLTV--WG 179
            ...:...|.|..|.. .....||.|||::..:.:|..::||||  ...:|...|.    ||  ||
  Fly   166 QRAVTAVIKHKSFDP-DTYNNDIALLRLRKPISFSKIIKPICLPRYNYDPAGRIG----TVVGWG 225

  Fly   180 TTAE--DFRSIPRVLKHSVGD----RIDRELCTLKFQQQVDESQICVHTETSHACKGDSGGPFSA 238
            .|:|  :..||...:|..:..    |..|...|     ::..|.:|....:..:|:||||||   
  Fly   226 RTSEGGELPSIVNQVKVPIMSITECRNQRYKST-----RITSSMLCAGRPSMDSCQGDSGGP--- 282

  Fly   239 KILYGGTYRTFQFGIIIFGLSSCA--GL-SVCTNVTFYMDWIWDALVN 283
             :|.....:.|..||:.:|: .|.  |. .|.:.|:.::.||...|.|
  Fly   283 -LLLSNGVKYFIVGIVSWGV-GCGREGYPGVYSRVSKFIPWIKSNLEN 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 68/235 (29%)
Tryp_SPc 57..277 CDD:238113 68/235 (29%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 71/252 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.