DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG7142

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster


Alignment Length:341 Identity:74/341 - (21%)
Similarity:124/341 - (36%) Gaps:101/341 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAALLILFASLFLGSREGSAFLLDAECGRSLPTNAKLT-------------------------WW 44
            ||:::::.:|...||.:....   .:||......|..|                         |.
  Fly    16 IASIMVVLSSASSGSIQLPTV---RKCGGGRSAGAAHTMAMNLAAYGLLENRISTLEAPRQTHWT 77

  Fly    45 NYFDSSTDI--QANPWIVSV--------IVNGKAKCSGSLINHRFVLTAAHCVFR----EAMQVH 95
            ..|.:..:.  .:.|::||:        :|:   .|:|::||..::||||||:..    |...:.
  Fly    78 KKFLAKREATPHSAPYVVSIQMMTPDQGLVH---YCAGTIINEHWILTAAHCLSSPQAVENSVIV 139

  Fly    96 LGDFDAWNPGQNCSSGARLSNAYCVRIDKKIVHAGF-GKIQAQQYDIGLLRMQHAVQYSDFVRPI 159
            .|..|..:      .....||.....||..:.|..: |.:  ..|||.|:..:..:.:..:|:|.
  Fly   140 AGSHDIHD------QKGEASNIQMRHIDYYVRHELYLGGV--NPYDIALIYTKEPLVFDTYVQPA 196

  Fly   160 CLLINEPVAAIDRF-QLTVWG----TTAEDFRSIPRVLKHSVGDRIDRELCTLKFQQQV------ 213
            .|  .|..|..:.: .|..||    |...::   |..|:.:....:|.|||     :|:      
  Fly   197 TL--PEQDAQPEGYGTLYGWGNVSMTAVPNY---PHRLQEANMPILDMELC-----EQILARSGL 251

  Fly   214 --DESQICVHTETS--HACKGDSGGPF----------SAKILYGGTYRTFQFGIIIFGLSSCA-- 262
              .|:.:|....|.  ..|..|||||.          .|.|:         .||:.:|...|.  
  Fly   252 PLHETNLCTGPLTGGVSICTADSGGPLIQQCCEEHFEQANIV---------IGIVSWGKMPCGQK 307

  Fly   263 -GLSVCTNVTFYMDWI 277
             ..||...|:.:.:||
  Fly   308 NAPSVFVRVSAFTEWI 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 61/260 (23%)
Tryp_SPc 57..277 CDD:238113 61/260 (23%)
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 63/270 (23%)
Tryp_SPc 84..323 CDD:214473 61/268 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.