DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG31266

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:241 Identity:68/241 - (28%)
Similarity:102/241 - (42%) Gaps:37/241 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 STDIQAN-PWIVSVIVNGKA--KCSGSLINHRFVLTAAHCV--FREA-MQVHLGDFDAWN---PG 105
            :|..:.| |||.| |.|..:  .|...:::..:|||||.||  .|.. :.|..|..|.|:   |.
  Fly    56 TTAAEGNWPWIAS-IQNAYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDWWDLYAPY 119

  Fly   106 QNCSSGARLSNAYCVRIDKKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAI 170
            ...|.    .:.:| ..||.:.|          .||.||::...::::|..:.|.|...:.:...
  Fly   120 YTVSQ----IHVHC-NFDKPLYH----------NDIALLQLSSKIEFNDVTKNITLADIDELEEG 169

  Fly   171 DRFQLTVWGTTAEDFRSIPRVLKHSVGDRIDRELCTLKFQQQ--VDESQICVHTETSH-ACKGDS 232
            |:.....|| ::|...:..|.|:.:.|..:..:.|..|.|.|  ||...:||..:... ||.||:
  Fly   170 DKLTFAGWG-SSEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQMDAGQGACHGDT 233

  Fly   233 GGPFSAKILYGGTYRTFQFGIIIFGLSSCAGL-SVCTNVTFYMDWI 277
            |||     |.....|.  .||..:|:....|. .|.....||.|||
  Fly   234 GGP-----LIDEQQRL--VGIGNWGVPCGRGYPDVYARTAFYHDWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 64/231 (28%)
Tryp_SPc 57..277 CDD:238113 64/231 (28%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 66/239 (28%)
Tryp_SPc 52..275 CDD:238113 68/241 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.